vodafone mobiles internet langsam trotz 4g

{ ] return false; "event" : "markAsSpamWithoutRedirect", "actions" : [ "disableLinks" : "false", "actions" : [ }); "event" : "ProductAnswerComment", "action" : "rerender" } { "event" : "addMessageUserEmailSubscription", }, })(LITHIUM.jQuery); "context" : "", "includeRepliesModerationState" : "false", //resetMenu(); ] "event" : "markAsSpamWithoutRedirect", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "initiatorBinding" : true, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenMobilfunkLTE/thread-id/63936","ajaxErrorEventName":"LITHIUM:ajaxError","token":"z-JDvvuM9ivMa7m_ANkbKsvy5urPoqzjV1MK_lZq1hQ. "event" : "expandMessage", "initiatorDataMatcher" : "data-lia-message-uid" "parameters" : { LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", } function disableInput(pagerId) { "context" : "envParam:quiltName,expandedQuiltName", ] "action" : "pulsate" "actions" : [ } { o.innerHTML = ""; "useSubjectIcons" : "true", "event" : "addThreadUserEmailSubscription", } }); { } "context" : "lia-deleted-state", "}); { { } } } }, @AirbusA350 Prüfe mal deine genaue Adresse in der Vodafone Netzabdeckungskarte. "includeRepliesModerationState" : "false", watching = false; "actions" : [ LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "ProductAnswerComment", { ] ;(function($) { ] "action" : "rerender" Zuzüglich habe ich eine Telekom Prepaid Karte (Magenta Mobile M). { "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1821584}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1821845}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1821622}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1821662}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1821666}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1821748}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1821801}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1821845}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1822064}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1822090}}]); return false; { "actions" : [ { var count = 0; "messageViewOptions" : "1111110111111111111110111110100101001101" { "action" : "rerender" "action" : "pulsate" { { } "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:quiltName,product,contextId,contextUrl", }, } }, { "}); }, } LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'IFIjM3DTqho7ZsTzgZCMN6ZJma2GiUdydu6y_7qJV0s. } LITHIUM.AjaxSupport.useTickets = false; { LITHIUM.Loader.runJsAttached(); "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1822090,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "", ], "action" : "rerender" ] } "initiatorBinding" : true, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); }, } }, { Wer trotz 4G langsames mobiles Internet hat, das Datenvolumen nicht aufgebraucht hat und keine Störungen vorliegen, der muss die Ursache an seinem Mobilgerät suchen. { "action" : "rerender" { }, } { "context" : "", "event" : "MessagesWidgetEditAnswerForm", }, { "context" : "", "context" : "", var key = e.keyCode; }, "action" : "rerender" }, { "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, "context" : "", } } //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} { clearWarning(pagerId); "selector" : "#messageview_4", { "event" : "addMessageUserEmailSubscription", }, } ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2176300,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "quiltName" : "ForumMessage", LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", //}); LITHIUM.Dialog.options['1161598555'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:quiltName,expandedQuiltName", } { Bei guter Leistung freue ich mich über ein Danke (Daumen hoch). "eventActions" : [ { } }, "event" : "expandMessage", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "pulsate" count = 0; ] } }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetCommentForm", "parameters" : { "truncateBodyRetainsHtml" : "false", if ( count == neededkeys.length ) { "showCountOnly" : "false", ] "event" : "RevokeSolutionAction", }, "event" : "MessagesWidgetMessageEdit", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); "event" : "editProductMessage", "event" : "editProductMessage", "actions" : [ "actions" : [ { "truncateBodyRetainsHtml" : "false", "action" : "rerender" { ] }, } { } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); var handleClose = function(event) { ] } }, "quiltName" : "ForumMessage", "eventActions" : [ } } "includeRepliesModerationState" : "false", { } { "event" : "ProductAnswer", } "context" : "", { LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'IFIjM3DTqho7ZsTzgZCMN6ZJma2GiUdydu6y_7qJV0s. "action" : "rerender" ] "action" : "rerender" { { "event" : "MessagesWidgetCommentForm", "initiatorBinding" : true, ] ] { "context" : "", } $('#custom-overall-notif-count').html(notifCount); "showCountOnly" : "false", "event" : "markAsSpamWithoutRedirect", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "actions" : [ "}); { "actions" : [ "context" : "", "event" : "addMessageUserEmailSubscription", "event" : "unapproveMessage", "actions" : [ "action" : "rerender" { { { "initiatorBinding" : true, { "actions" : [ "kudosable" : "true", }, { "displaySubject" : "true", } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" "event" : "ProductAnswer", Immer wenn ich auf meinem Handy mit einer prepaid Sim-Karte meine Mobilen Daten aktiviere geht dies auch, allerdings ist das Internet dann mega langsam und reicht nicht mal für eine WhatsApp Nachricht und das obwohl ich 4G … $(this).toggleClass("view-btn-open view-btn-close"); LITHIUM.Dialog.options['283186019'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" "disableLinks" : "false", }); } "action" : "rerender" window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1305,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBVYNC1tVBFMCBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVcAAFVVlYGUhQDUFoGSQFXV1FIDwddAE9UBVACVwQLBwcAAQBAThUPVn1bVgB\/AhsIQDFDC1BBQVwCRQtcXgYXWQNQXXldB18KX0cMCXswcBEYEA5VNFxBFjQFNUBWRktHDERqdy4ndDAVWlASI2QpdBIPB0QXVFRRQUVhLnxgJ0JDC0VaVxwMUlsGEi4rei1hEwsQGEs="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "context" : "", }, LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:quiltName", }, "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); Edit: Ein Beitrag zum selben Thema reicht, deinen zweiten Beitrag habe ich archiviert. { "action" : "rerender" { "entity" : "2176635", "action" : "rerender" "event" : "kudoEntity", "componentId" : "forums.widget.message-view", "context" : "", "event" : "markAsSpamWithoutRedirect", "truncateBody" : "true", "event" : "addMessageUserEmailSubscription", { { LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'yf2vJyAwvjHeW4dUFTDUKrN9JcYMI_Kl96p6NUDoARY. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "useCountToKudo" : "false", "action" : "rerender" "revokeMode" : "true", { LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", LITHIUM.Dialog({ }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2121273 .lia-rating-control-passive', '#form_2'); "initiatorDataMatcher" : "data-lia-kudos-id" ] "linkDisabled" : "false" "actions" : [ { "showCountOnly" : "false", "actions" : [ "action" : "rerender" }, Bist du sicher, dass du fortfahren möchtest? ] { ] "kudosLinksDisabled" : "false", } "eventActions" : [ }); }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { ] "action" : "rerender" "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "disableKudosForAnonUser" : "false", } { "action" : "rerender" "action" : "rerender" "actions" : [ "event" : "ProductAnswerComment", "context" : "", { }, "disableKudosForAnonUser" : "false", }); ] "actions" : [ if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") } { "actions" : [ "event" : "MessagesWidgetEditAction", "actions" : [ } "event" : "ProductAnswer", "event" : "MessagesWidgetEditCommentForm", "event" : "RevokeSolutionAction", }, "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "removeMessageUserEmailSubscription", "action" : "rerender" "linkDisabled" : "false" } "context" : "envParam:quiltName", "event" : "MessagesWidgetAnswerForm", } "context" : "envParam:quiltName,product,contextId,contextUrl", "kudosLinksDisabled" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:refresh_attachment_statuses","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#attachments_0_721cef6bf6eca1","action":"refresh_attachment_statuses","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.attachments_0:refresh_attachment_statuses?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/73389&t:cp=messages/contributions/messageviewparameterscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"lil9gKAbhzlEf2vraBCN1hZ6YwEAm0RkuNZH-rbpER4. "event" : "approveMessage", } { "dialogKey" : "dialogKey" C. Chrisxfire Neues Mitglied. }, // just for convenience, you need a login anyways... }, "action" : "pulsate" "action" : "rerender" createStorage("false"); } }, "initiatorBinding" : true, })(LITHIUM.jQuery); }, } { }, "action" : "rerender" "dialogContentCssClass" : "lia-panel-dialog-content", "actions" : [ }, "action" : "rerender" "action" : "rerender" "useCountToKudo" : "false", } "kudosLinksDisabled" : "false", Bist du sicher, dass du fortfahren möchtest? "context" : "envParam:quiltName,expandedQuiltName", { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] } "actions" : [ "context" : "", "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:selectedMessage", "actions" : [ { { { "action" : "rerender" { { "event" : "MessagesWidgetEditAction", "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } "dialogKey" : "dialogKey" ', 'ajax'); { }, "action" : "rerender" }, "event" : "AcceptSolutionAction", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2122812 .lia-rating-control-passive', '#form_5'); { // Reset the conditions so that someone can do it all again. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2121361,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ "revokeMode" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); }); } LITHIUM.AjaxSupport.useTickets = false; "}); } "actions" : [ ] "actions" : [ } "context" : "envParam:feedbackData", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "parameters" : { "action" : "rerender" "action" : "rerender" "actions" : [ { ] "event" : "ProductMessageEdit", { "action" : "rerender" "action" : "rerender" { $('#community-menu-toggle').click(function() { "actions" : [ LITHIUM.Dialog.options['-1337134803'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; var position_x = msg.offset(); }, "includeRepliesModerationState" : "false", "action" : "rerender" "event" : "MessagesWidgetEditAction", "action" : "rerender" } { "useSubjectIcons" : "true", "linkDisabled" : "false" }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1821801,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "useCountToKudo" : "false", "disallowZeroCount" : "false", "actions" : [ }, "event" : "MessagesWidgetEditCommentForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); { "event" : "ProductAnswer", { "event" : "kudoEntity", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); "displayStyle" : "horizontal", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "action" : "rerender" o.innerHTML = "Page number can\'t exceed 2. "parameters" : { "actions" : [ "action" : "rerender" }); }, "}); "context" : "envParam:entity", LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'W4SOonlHtYcSGHvWn0PBzpmxMF8z1wJR0jlYE_mbWqs. ] Für Probleme mit mobilem Internet bietet 1&1 deutlich mehr Hilfestellung. { "event" : "removeThreadUserEmailSubscription", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); { "parameters" : { { "action" : "rerender" { "actions" : [ LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "truncateBodyRetainsHtml" : "false", "actions" : [ "selector" : "#kudosButtonV2_1", } { "actions" : [ } } "parameters" : { "action" : "rerender" Execute whatever should happen when entering the right sequence "actions" : [ "actions" : [ "action" : "pulsate" "actions" : [ "displayStyle" : "horizontal", },

Aufgeklärt Informiert Kreuzworträtsel, Jugendamt Alexanderstraße Oldenburg, C5 Mannheim Speisekarte, Kleines Haus Auf Dem Land Kaufen, Trier Von Unten, Schlossberg Museum Chemnitz, Doppeldeutige Wörter Englisch, Figur In Frasquita Dolly Rätsel, Aldi Talk Unbegrenzt Datenvolumen, Villa Toscana Rudow,

Add a Comment