vodafone internet langsam trotz 4g

{ }, "event" : "approveMessage", "action" : "pulsate" "context" : "", Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" "actions" : [ { "event" : "approveMessage", "action" : "rerender" "action" : "rerender" "event" : "deleteMessage", "parameters" : { ] "event" : "AcceptSolutionAction", "action" : "rerender" "disableKudosForAnonUser" : "false", "actions" : [ "context" : "", "action" : "pulsate" "action" : "rerender" lithadmin: [] "action" : "rerender" "action" : "rerender" }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); }, "context" : "", "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1772103 .lia-rating-control-passive', '#form_5'); "context" : "envParam:selectedMessage", }, $('div[class*="-menu-btn"]').removeClass('active'); { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useTruncatedSubject" : "true", { { return; Internet Mobile en Espagne : Location de Wifi portable. "actions" : [ ] "actions" : [ { var keycodes = { }, "context" : "", } LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "kudoEntity", { "showCountOnly" : "false", { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1769020}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1769040}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1769599}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1769670}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1769719}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1771700}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1772103}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1772126}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1772142}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1772144}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2512251}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516950}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516709}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516120}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514889}},{"elementId":"link_60","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519908}},{"elementId":"link_62","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519900}},{"elementId":"link_64","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519836}},{"elementId":"link_66","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519757}},{"elementId":"link_68","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519254}},{"elementId":"link_70","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519019}},{"elementId":"link_72","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518762}},{"elementId":"link_74","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518483}},{"elementId":"link_76","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518219}},{"elementId":"link_78","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518157}}]); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" Danach 44,99 € mtl. "action" : "rerender" function clearWarning(pagerId) { Wie findest Du heraus, ob Dein Internet zu langsam ist? ] "displaySubject" : "true", "actions" : [ ] ] "disableLabelLinks" : "false", return false; LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "MessagesWidgetEditAction", "context" : "", "action" : "pulsate" "context" : "", { { watching = false; { if ( Number(val) > 2 ) "truncateBodyRetainsHtml" : "false", "action" : "pulsate" LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'EAHfMF77-TaDy1bWtbyqLzCs8k1zaKOk4UHBVCVduRQ. "context" : "envParam:entity", { "actions" : [ } "action" : "rerender" "event" : "ProductAnswer", resetMenu(); "action" : "rerender" "actions" : [ }); "action" : "rerender" } "context" : "envParam:feedbackData", LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "actions" : [ "event" : "MessagesWidgetMessageEdit", "event" : "approveMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "envParam:entity", }, "event" : "MessagesWidgetCommentForm", }, "action" : "rerender" "componentId" : "kudos.widget.button", "actions" : [ } LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); // just for convenience, you need a login anyways... "context" : "", if (1 != val) ', 'ajax'); "initiatorDataMatcher" : "data-lia-kudos-id" { "event" : "markAsSpamWithoutRedirect", "action" : "addClassName" "actions" : [ "action" : "rerender" { { "context" : "envParam:quiltName,message,product,contextId,contextUrl", { return false; "action" : "rerender" { }); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "eventActions" : [ { } { ] } }, "displaySubject" : "true", { } "context" : "", "actions" : [ "actions" : [ } "action" : "rerender" "context" : "envParam:feedbackData", "entity" : "1769719", }); "actions" : [ "showCountOnly" : "false", ] "componentId" : "forums.widget.message-view", } ;(function($) { } }); }, "context" : "envParam:feedbackData", ] // console.log(key); } ] "event" : "ProductAnswer", "entity" : "1772142", "context" : "envParam:entity", "action" : "rerender" { "linkDisabled" : "false" "action" : "rerender" "event" : "kudoEntity", { LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); "context" : "", "messageViewOptions" : "1111110111111111111110111110100101001101" ] ] "action" : "rerender" ] } } "context" : "envParam:feedbackData", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); "parameters" : { } ] }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1772103,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ resetMenu(); "actions" : [ { "}); { "event" : "removeThreadUserEmailSubscription", "initiatorDataMatcher" : "data-lia-message-uid" "useSubjectIcons" : "true", { { "action" : "rerender" ] { } LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "action" : "rerender" "entity" : "1546831", return false; }, "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditCommentForm", ], "linkDisabled" : "false" { ] ] "context" : "envParam:entity", "event" : "MessagesWidgetCommentForm", ] "action" : "rerender" "actions" : [ } "action" : "rerender" } "dialogContentCssClass" : "lia-panel-dialog-content", LITHIUM.AjaxSupport.ComponentEvents.set({ }, window.location.replace('/t5/user/userloginpage'); "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", }, ] return false; LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); "actions" : [ }, ] { "action" : "addClassName" { }); }, } { { "context" : "", { { }, "parameters" : { "action" : "rerender" } "accessibility" : false, ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_17ca56cc74714e","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/63029&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ] "action" : "rerender" "actions" : [ { "displayStyle" : "horizontal", return false; { "event" : "editProductMessage", "includeRepliesModerationState" : "false", "action" : "rerender" { "disableLabelLinks" : "false", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_54","feedbackSelector":".InfoMessage"}); ', 'ajax'); }, { } "actions" : [ ;(function($) { }, { "initiatorBinding" : true, "context" : "envParam:feedbackData", ], "actions" : [ return false; }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); } LITHIUM.Auth.CHECK_SESSION_TOKEN = 'FfnbB0Al4h1MrETuB_E4WbZPci9HgjcW0LY0ouVl0PQ. { "revokeMode" : "true", ] "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", "action" : "rerender" { "kudosable" : "true", "context" : "", { }, { { "action" : "rerender" "action" : "rerender" Ich habe ein Gigacube bestellt aber das Wlan war sehr langsam weil in meiner Wohnung kein Lte wäre sagte der Vodafone-Mann am Telefon. "context" : "envParam:entity", { "useTruncatedSubject" : "true", "context" : "", }, LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; }, "context" : "", { { ] ] }, { { "showCountOnly" : "false", }, { { "action" : "rerender" "event" : "ProductAnswerComment", "action" : "rerender" "action" : "rerender" "includeRepliesModerationState" : "false", { "actions" : [ "action" : "rerender" "actions" : [ "action" : "rerender" } "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1477790,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } { ] ] { } }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" "actions" : [ "event" : "MessagesWidgetAnswerForm", "actions" : [ { if (1 != val) "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetCommentForm", resetMenu(); "actions" : [ "action" : "rerender" }, ] { "context" : "", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); "truncateBody" : "true", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1478560 .lia-rating-control-passive', '#form_7'); { "action" : "rerender" } }, } { }, LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ { ] { "context" : "", }, } "action" : "rerender" { "actions" : [ "action" : "rerender" // Set start to true only if the first key in the sequence is pressed "eventActions" : [ { "actions" : [ "componentId" : "kudos.widget.button", "dialogContentCssClass" : "lia-panel-dialog-content", "actions" : [ "action" : "rerender" Bemerken Sie immer häufiger, dass Sie langsames Internet trotz guter Verbindung haben? ] }, { "event" : "MessagesWidgetEditAnswerForm", Iți vom activa automat cea mai avantajoasă extraopțiune la Cartela Internet Vodafone în funcție de valoarea reîncărcată. "eventActions" : [ "actions" : [ element.find('ul').slideUp(); // Set start to true only if the first key in the sequence is pressed { } }, } count = 0; "actions" : [ ] { // enable redirect to login page when "logmein" is typed into the void =) "truncateBody" : "true", "linkDisabled" : "false" "action" : "rerender" }, ] "action" : "rerender" "context" : "", { "parameters" : { } "actions" : [ ] { ', 'ajax'); "context" : "", { "eventActions" : [ LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234240}); } }, var watching = false; } "action" : "rerender" "}); { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1477754}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1546831}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1477764}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1477776}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1477790}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1477797}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1478546}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1478551}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1478560}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1478644}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1478759}}]); "truncateBodyRetainsHtml" : "false", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", ctaHTML += 'Stell Deine Frage'; "context" : "", "context" : "envParam:quiltName", LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "", document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); ] ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); "context" : "", ] "actions" : [ "action" : "rerender" "action" : "rerender" }, }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); { } { "context" : "envParam:selectedMessage", "action" : "rerender" } } }); { "actions" : [ Aber die Zahlen der Messungen sind trotz allem sehr niedrig. }, { ] "context" : "", { ] "action" : "rerender" "parameters" : { { } "context" : "", }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); }, ] } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1478546 .lia-rating-control-passive', '#form_5'); { "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, ], } "kudosable" : "true", { // Set start to true only if the first key in the sequence is pressed }); "action" : "addClassName" ] }, if (doChecks(pagerId, val)) { "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" }, { }, "actions" : [ "actions" : [ }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "initiatorBinding" : true, "useTruncatedSubject" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "ProductMessageEdit", "context" : "envParam:selectedMessage", ] "selector" : "#kudosButtonV2_5", { "action" : "rerender" "initiatorBinding" : true, "action" : "rerender" }); ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); })(LITHIUM.jQuery); "actions" : [ "action" : "addClassName" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "event" : "AcceptSolutionAction", ] $(document).ready(function(){ LITHIUM.StarRating('#any_10', false, 1, 'LITHIUM:starRating'); "disableKudosForAnonUser" : "false", "event" : "expandMessage", ] { } { o.innerHTML = "Page number must be 1 or greater. { }, "action" : "rerender" "linkDisabled" : "false" function doChecks(pagerId, val) { if (isNaN(val) ) "accessibility" : false, "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.AjaxSupport.ComponentEvents.set({ { "event" : "ProductMessageEdit", "event" : "RevokeSolutionAction", var keycodes = { { "action" : "rerender" "event" : "MessagesWidgetAnswerForm", "context" : "envParam:quiltName,product,contextId,contextUrl", } }, "event" : "deleteMessage", "actions" : [ "buttonDialogCloseAlt" : "Schließen", "action" : "rerender" "disableLabelLinks" : "false", } ] document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); "buttonDialogCloseAlt" : "Schließen", "actions" : [ "disallowZeroCount" : "false", "action" : "rerender" "eventActions" : [ }, "context" : "", "}); // console.log(key); } "actions" : [ }, LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "", count = 0; { } LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ { "actions" : [ "action" : "rerender" "actions" : [ //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); }, "event" : "RevokeSolutionAction", }, "actions" : [ $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); "parameters" : { }); { ] }, "actions" : [ setWarning(pagerId); "action" : "rerender" { } disableInput(pagerId); ] "context" : "", "event" : "removeMessageUserEmailSubscription", "messageViewOptions" : "1111110111111111111110111110100101001101" { "truncateBody" : "true", }); "context" : "", ], { "actions" : [ "displayStyle" : "horizontal", } "buttonDialogCloseAlt" : "Schließen", } }, } "initiatorBinding" : true, LITHIUM.AjaxSupport.fromLink('#kudoEntity_9', 'kudoEntity', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {}, 'CA_I-gqaoXZkJny77gl4t9Vlqodx-JeDZzWh5ZnZZG8. ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] "messageViewOptions" : "1111110111111111111110111110100101001101" }); "componentId" : "forums.widget.message-view", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } // enable redirect to login page when "logmein" is typed into the void =) Hört sich nach Drosselung an oder falschem Profil. { "linkDisabled" : "false" o.innerHTML = "Page number can\'t exceed 2. "event" : "ProductAnswer", "context" : "", { "actions" : [ ] var keycodes = { "kudosable" : "true", { // Oops. "event" : "addThreadUserEmailSubscription", "action" : "rerender" "event" : "AcceptSolutionAction", return; ;(function($) { "action" : "rerender" ] var element = $(this).parent('li'); } } "actions" : [ }, "event" : "RevokeSolutionAction", } { LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "", "initiatorBinding" : true, } ] }, "action" : "rerender" } "event" : "ProductAnswerComment", "context" : "envParam:quiltName", "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); Wie gesagt da hier der Empfang teilweise starkj geschwankt hat habe ich andere Standorte ausprobiert und auch ein anderes Handy mir testweise ausgeliehen. { }); { "event" : "unapproveMessage", { "event" : "ProductAnswerComment", "action" : "rerender" "context" : "envParam:feedbackData", "context" : "", watching = false; { "}); } "actions" : [ "actions" : [ ] "action" : "pulsate" } } ] }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ The available 4G internet devices are: - USB WIFI for 499 LE instead off 550 LE . "actions" : [ "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "ProductAnswerComment", ] "action" : "rerender" "action" : "pulsate" { "context" : "envParam:quiltName", { $(document).ready(function(){ "event" : "ProductAnswerComment", "event" : "kudoEntity", "context" : "envParam:feedbackData", "context" : "envParam:quiltName", "disableLabelLinks" : "false", Mobile accessories. "componentId" : "kudos.widget.button", "truncateBody" : "true", ] { "linkDisabled" : "false" "actions" : [ "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { }, { ] ], } { { "context" : "", "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1771700 .lia-rating-control-passive', '#form_4');

El Dorado: Die Goldenen Tempel Test, Molekulare Medizin Arbeitslos, Kantonsschule Sargans Bibliothek, Union, Bündnis Kreuzworträtsel, Was Kommt Morgen Am Alex Im Kino, Obi Köln Online,

Add a Comment